PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G54230.1
Common NameAtMYB49, MYB49
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 319aa    MW: 35736.5 Da    PI: 6.8456
Description myb domain protein 49
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G54230.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.2e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv +++ +G+g W+t ++  g++R++k+c++rw +yl
      AT5G54230.1 14 KGPWTPEEDEKLVGYIQTHGPGKWRTLPKNAGLKRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.79.6e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg ++ +E+e +++++++lG++ W++Ia +++ gRt++++k++w+++
      AT5G54230.1  67 RGEFSLQEEETIIQLHRLLGNK-WSAIAIHLP-GRTDNEIKNYWNTH 111
                      899*******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-25764IPR009057Homeodomain-like
PROSITE profilePS5129418.092961IPR017930Myb domain
SuperFamilySSF466892.96E-3012108IPR009057Homeodomain-like
SMARTSM007177.7E-141363IPR001005SANT/Myb domain
PfamPF002499.7E-161461IPR001005SANT/Myb domain
CDDcd001673.46E-111661No hitNo description
PROSITE profilePS5129425.8462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.3E-2665116IPR009057Homeodomain-like
SMARTSM007174.7E-1666114IPR001005SANT/Myb domain
PfamPF002491.6E-1567111IPR001005SANT/Myb domain
CDDcd001676.54E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGKSSSSEES EVKKGPWTPE EDEKLVGYIQ THGPGKWRTL PKNAGLKRCG KSCRLRWTNY  60
LRPDIKRGEF SLQEEETIIQ LHRLLGNKWS AIAIHLPGRT DNEIKNYWNT HIKKKLLRMG  120
IDPVTHCPRI NLLQLSSFLT SSLFKSMSQP MNTPFDLTTS NINPDILNHL TASLNNVQTE  180
SYQPNQQLQN DLNTDQTTFT GLLNSTPPVQ WQNNGEYLGD YHSYTGTGDP SNNKVPQAGN  240
YSSAAFVSDH INDGENFKAG WNFSSSMLAG TSSSSSTPLN SSSTFYVNGG SEDDRESFGS  300
DMLMFHHHHD HNNNALNLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-30111161105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible248203_at0.0
Expression AtlasAT5G54230-
AtGenExpressAT5G54230-
ATTED-IIAT5G54230-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB49).
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00563DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G54230.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, salicylic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G54230, AT1G10585, AT1G22190, AT1G52880
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G54230
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1759910.0AF175991.1 Arabidopsis thaliana putative transcription factor (MYB49) mRNA, complete cds.
GenBankAY0598200.0AY059820.1 Arabidopsis thaliana Myb-related transcription factor-like protein (At5g54230; MDK4.5) mRNA, complete cds.
GenBankAY0815120.0AY081512.1 Arabidopsis thaliana Myb-related transcription factor-like protein (At5g54230) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200234.10.0putative transcription factor MYB49
TrEMBLQ9SPG60.0Q9SPG6_ARATH; Myb-related transcription factor-like protein
STRINGAT5G54230.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144651722
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Broekgaarden C, et al.
    Genotypic variation in genome-wide transcription profiles induced by insect feeding: Brassica oleracea--Pieris rapae interactions.
    BMC Genomics, 2007. 8: p. 239
    [PMID:17640338]
  6. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  7. Lumba S, et al.
    A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis.
    Dev. Cell, 2014. 29(3): p. 360-72
    [PMID:24823379]
  8. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]